Curs
Curs d’introducció
d’introducció aa la
la bioinformàtica
bioinformàtica
Plataforma Bioinformàtica de la UAB
Introducció a la Bioinformàtica
Bioinformàtica: la recerca
biomèdica in silico
© 2006 Plataforma Bioinformàtica de la UAB
Curs
Curs d’introducció
d’introducció aa la
la bioinformàtica
bioinformàtica
Plataforma Bioinformàtica de la UAB
Proteómica:
Comparar
proteomas distintos
© 2006 Plataforma Bioinformàtica de la UAB
Comparar proteomas distintos
http://ural.wustl.edu/~billy/Procom/
© 2006 Plataforma Bioinformàtica de la UAB
Curs
Curs d’introducció
d’introducció aa la
la bioinformàtica
bioinformàtica
Plataforma Bioinformàtica de la UAB
Proteómica:
Identificación de
proteínas
© 2006 Plataforma Bioinformàtica de la UAB
Comparar proteomas distintos
http://us.expasy.org
© 2006 Plataforma Bioinformàtica de la UAB
Identificar una proteína desconocida
•Identificar una proteína desconocida
Tecnicas experimentales:
-Secuenciación de novo de péptidos
-Microchips de proteínas
-MALDI-TOF
-geles bidimensionales
combinadas con la bioinformatica
© 2006 Plataforma Bioinformàtica de la UAB
Identificar una proteína desconocida
© 2006 Plataforma Bioinformàtica de la UAB
Identificar una proteína desconocida
Identificación de una proteína a partir de sus
características fisicoquímicas y a partir de una digestión
enzimática
•Analysis
Whole Protein
•Molecular Weight
•Length
55746.95 m.w.
501
•Isoelectric Point
5.40
•Charge at pH 7-11.54
© 2006 Plataforma Bioinformàtica de la UAB
Identificar una proteína desconocida
•Acidic (DE)
•Basic (KR)
•Polar (NCQSTY)
•Hydrophobic (AILFWV)
N. count
•A Ala
35
•C Cys
11
•D Asp
27
•E Glu
28
•F Phe
22
•G Gly
42
•H His
11
•I Ile
29
•K Lys
16
•L Leu
48
•M Met
14
•N Asn
15
•P Pro
28
•Q Gln
20
N. count
55
42
129
180
% by weight % by frequency
12.06
10.98
10.96
8.38
26.13
25.75
35.64
35.93
% by weight % by frequency
4.46
6.99
2.04
2.20
5.57
5.39
6.49
5.59
5.81
4.39
4.30
8.38
2.71
2.20
5.89
5.79
3.68
3.19
9.74
9.58
3.29
2.79
3.07
2.99
4.88
5.59
4.60
N. count
•R Arg
•S Ser
•T Thr
•V Val
•W Trp
•Y Tyr
•B Asx
•Z Glx
•X Xxx
•. Ter
26
34
29
36
10
20
0
0
0
0
3.99
© 2006 Plataforma Bioinformàtica de la UAB
% by weight % by frequency
7.28
5.31
5.26
6.40
3.34
5.85
0.00
0.00
0.00
0.00
5.19
6.79
5.79
7.19
2.00
3.99
0.00
0.00
0.00
0.00
Identificar una proteína desconocida
Digestión enzimática
•Hydroxylamine - 4 cuts
•Position Length Weight
pI
1/2 life HPLC rt Fragment
•1
66
7185.32 5.64
>20h
81.24
MAPALHWLL...GSFVEMVDN
•67
106
11717.18 9.10
3m
85.54
LRGKSGQGY...TESDKFFIN
•173
98
10902.40 4.46
>20h
88.02
GSNWEGILG...VIIVRVEIN
•271
24
2723.94 4.13
>20h
57.76
GQDLKMDCK...SIVDSGTTN
•295
207
23286.10 5.34
3m
96.18
LRLPKKVFE...FADDISLLK
© 2006 Plataforma Bioinformàtica de la UAB
Identificar una proteína desconocida
Try psin - 39 c uts
1
Digestión enzimática
28
32
43
46
57
58
69
71
27 292 5.5 4
9. 96
>20 h
73. 13
MA P A L HW L L ...A Q G THL G IR
496 .62 10. 04
3m
13. 17
LPLR
11 103 6.2 1 10. 04
>20 h
19. 83
SG LAG PPLG LR
3m
8. 26
3. 67
30m
10. 79
173 .19 10. 04
2m
0. 00
4. 17
>20 h
17. 86
202 .22
9. 00
>20 h
0. 00
41 431 5.8 1
6. 30
>20 h
72. 47
S G Q G Y Y V E M...A A P HP FL HR
4
3
383 .46 10. 04
11 127 6.2 1
1
11 126 5.4 3
2
LPR
E TDE E S E E P G R
R
G S FV E MV DNL R
GK
112
4
627 .67
8. 88
10m
12. 08
YYQR
116
7
852 .92
9. 04
10m
13. 92
Q L S S TY R
123
3
401 .44
6. 01
3m
6. 47
DL R
126
1
145 .17
9. 00
3m
0. 00
K
127
10 111 0.2 4
8. 77
>20 h
16. 56
G V Y V P Y TQ G K
137
21 227 5.5 2
4. 55
?
64. 01
W E G E L G TDL V S IP HG P NV TV R
158
11 113 1.2 2
4. 18
>20 h
13. 17
A NIA A ITE S DK
169
35 393 1.3 9
3. 82
3m
74. 41
FFING S NW E ...E P FFDS L V K
204
52 554 6.3 5
6. 29
10m
79. 67
Q THIP NIFS ...G S L W Y TP IR
173 .19 10. 04
2m
0. 00
256
1
R
257
10 136 8.5 7
4. 44
30m
24. 44
E W Y Y E V IIV R
267
9 101 4.1 1
4. 18
>20 h
13. 86
V E ING Q DL K
276
4
494 .60
5. 95
>20 h
2. 39
MDCK
280
6
829 .83
4. 18
30m
9. 72
E Y NY DK
11 116 1.2 5
6. 01
>20 h
14. 38
286
S IV DS G TTNL R
297
3
355 .45
9. 00
3m
7. 30
LPK
300
1
145 .17
9. 00
3m
0. 00
K
301
7
761 .89
6. 22
>20 h
11. 98
308
3
345 .41
9. 00
>20 h
6. 01
S IK
311
7
691 .71
6. 22
>20 h
2. 79
A A S S TE K
318
41 474 8.4 4
3. 96
3m
77. 77
FP DG FW L G E ...G E V TNQ S FR
359
24 279 5.1 4
3. 99
30m
65. 58
ITIL P Q Q Y L ...A TS Q DDCY K
383
26 279 8.2 1
4. 18
3m
68. 07
FA V S Q S S TG ...E G FY V V FDR
>20 h
0. 00
AR
V FE A A V K
409
2
244 .27 10. 04
411
1
145 .17
9. 00
3m
0. 00
K
412
1
173 .19 10. 04
2m
0. 00
R
413
15 168 6.8 9
6. 29
30m
59. 78
IG FA V S A CHV HDE FR
428
54 594 9.0 9
3. 48
>20 h
78. 71
TA A V E G P FV ...L CL MV CQ W R
© 2006 Plataforma Bioinformàtica de la UAB
Identificar una proteína desconocida
•http://us.expasy.org/tools/#proteome
© 2006 Plataforma Bioinformàtica de la UAB
Identificar una proteína desconocida
© 2006 Plataforma Bioinformàtica de la UAB
Identificar una proteína desconocida
© 2006 Plataforma Bioinformàtica de la UAB
Identificar una proteína desconocida
Proteína problema (obtenida directamente del banco de datos)
MRVLLVALALLALAASATSTHTSGGCGCQPPPPVHLPPPVHLPPPVHLPP
PVHLPPPVHLPPPVHLPPPVHVPPPVHLPPPPCHYPTQPPRPQPHPQPHPC
PCQQPHPSPCQLQGTCGVGSTPILGQCVEFLRHQCSPTATPYCSPQCQSL
RQQCCQQLRQVEPQHRYQAIFGLVLQSILQQQPQSGQVAGLLAAQIAQQ
LTAMCGLQQPTPCPYAAAGGVPH
Purificada de maiz (Zea mays)
Pm: ¿?
pI: ¿?
Composicio de aa: ¿?
Masa molecular de los peptidos por digestión con tripsina: ¿?
© 2006 Plataforma Bioinformàtica de la UAB
Identificar una proteína desconocida
© 2006 Plataforma Bioinformàtica de la UAB
Identificar una proteína desconocida
© 2006 Plataforma Bioinformàtica de la UAB
Identificar una proteína desconocida
© 2006 Plataforma Bioinformàtica de la UAB
Identificar una proteína desconocida
© 2006 Plataforma Bioinformàtica de la UAB
Identificar una proteína desconocida
PROTEINA PROBLEMA:
Purificada de maiz (Zea mays)
Pm: 23688.6
pI: 8.40
Composicio de aa:
Ala (A) 16 7.2%
Cys (C) 15 6.7%
His (H) 16 7.2%
(M) 2 0.9%
(T) 10 4.5%
Arg (R) 6 2.7%
Gln (Q) 30 13.5%
Ile (I) 4 1.8%
Phe (F) 2 0.9%
Trp (W) 0 0.0%
Asn (N) 0 0.0%
Glu (E) 2 0.9%
Leu (L) 25 11.2%
Pro (P) 51 22.9%
Tyr (Y) 4 1.8%
Asp (D) 0 0.0%
Gly (G) 13 5.8%
Lys (K) 0 0.0% Met
Ser (S) 10 4.5% Thr
Val (V) 17 7.6%
Masa molecular de los peptidos por digestión con tripsina:
305.4
13690.2
2107.4
1006.2
892.9
5776.7
© 2006 Plataforma Bioinformàtica de la UAB
Curs
Curs d’introducció
d’introducció aa la
la bioinformàtica
bioinformàtica
Plataforma Bioinformàtica de la UAB
Proteómica:
Identificación de
interacciones
© 2006 Plataforma Bioinformàtica de la UAB
Identificar interacciones entre proteínas
Interacciones descritas
en el proteoma de
levadura
© 2006 Plataforma Bioinformàtica de la UAB
Identificar interacciones entre proteínas
http://dip.doe-mbi.ucla.edu/dip/Search.cgi
© 2006 Plataforma Bioinformàtica de la UAB
Identificar interacciones entre proteínas
© 2006 Plataforma Bioinformàtica de la UAB
Descargar

Proteómica