ISB - Ion Source & Biotechnologies
Espectrometria de Masas
Analítica Química, tecnología de vanguardia en
beneficio del Sector Agroindustrial
Simone Cristoni, Ph.D.
Founder & CEO
Cell: +39 389.8517491
Email: [email protected]
ISB Headquarters & Laboratories: Insubrias BioBiopark, Via Roberto Lepetit ,34
Gerenzano (VA) – Italy.
Tel. +39 02.96474437 - Fax +39 02.700410252.
Ubicación
Insubrias BioPark
Fundada en el año 2006
Subvención del gobierno: € 1200000
Vision
La espectrometria de masas en cada laboratorio a
nivel internacional
Mission
• Productos (SACI kits)
• Servicio de
Investigación Científica
• Transferimento de
Conocimientos
Red de colaboración
Espectrometria de Masas
Sistema
preparativa
Separación
molecular
UPLC
Fuente de
ionización
Analizador
de masa
Bioinformática
Espectrometria de Masas
Espectrometria de Masas
• Sensibilidad
• Selectividad
• Cualitativo
• Cuantitativo
• Aplicaciones
personalizadas
• Analisis multiresidual
Espectrometria de Masas
Tecnología ISB
Low discharge Surface Activated Chemical Ionization
Mass Spectrometry application kit
(SACI PCT Patent n. and WO/2007/131682)
Preparación kit
SACI
HPLC
Espectrómetro de masas
Bioinformática
SACI
• Food and Drugs Administration
• Bruker Daltonics
• Thermoschientific
• Universidad de Milán
• Waters corporation
SACI aplicationes agroindustriales
• Garantizar el cumplimiento
de la normativa europea
• Control de calidad
• Control y certificación de
origen
SACI aplicationes agroindustriales
• Análisis de los pesticidas
• Análisis de toxinas en alimentos
• Origen geográfico de las matrices
vegetales
• Identificación de proteínas
Análisis de los pesticidas
Cuantificación simultánea de 6 pesticidas en las
espinacas
Análisis de los pesticidas
(Reglamento CE n. 91/414/CEE)
Concentración máxima permitida: 0.02-50 ppb)
a
Base peak chromatogram of
spinaches extract
b
1)
2)
3)
4)
5)
6)
4
1
2
3
5
6
Figure 2: a) Base peak and b) Extracted Ion Current (EIC) of spinaches extract obtained by SACI source; pesticides detectable in
the biological sample are reported.
isoproturon
daminozide
ethirimol
piridate
dietofencarb
metabentiazuron
Análisis de toxinas en alimentos
Análisis de vino que contiene OTA
(Regolamento CE n. 123/2005)
Concentración máxima permitida: 2 ppb)
Análisis de toxinas en alimentos
Análisis de vino que contiene OTA
(Reglamento CE n. 123/2005)
Concentración máxima permitida: 2 ppb)
Análisis de toxinas en alimentos
Análisis de vino que contiene OTA
(Reglamento CE n. 123/2005)
Concentración máxima permitida: 2 ppb)
Vino
Concentración
(ppb)
Cabernet Sauvignon
13.1
Valpolicella
9.2
Negroamaro
9.4
Origen geogràfico de las matrices
vegetales
Proyecto europeo
Origen geogràfico de las matrices
vegetales
Proyecto europeo
Origen geográfico de las matrices
vegetales
Proyecto europeo
Turkey (Izmir)
In te n s.
x 1 07
1 .5 0
France (Provence)
Italy (Liguria)
1 .2 5
1 .0 0
0 .7 5
0 .5 0
0 .2 5
2 .5
5 .0
7 .5
1 0 .0
1 2 .5
1 5 .0
1 7 .5
2 0 .0
2 2 .5
T im e [m in ]
Origen geogràfico de las matrices
vegetales
Proyecto europeo
Turkey-Izmir (non-Liguria)
In te n s.
x 1 06
2 .0
+ M S , 1 9 .2 -1 9 .4 m in # (4 6 8 7 -4 7 3 1 ), B a c kg ro u n d S u b tra c te d
1 0 9 .1 0
1 .5
1 2 6 .9 8
1 .0
9 5 .2 1
0 .5
1 4 2 .9 5
8 3 .3 3
6 7 .5 4
5 5 .5 0
1 2 1 .0 0
1 3 0 .9 8
1 3 8 .9 4
1 5 2 .9 2
2 0 4 .9 4
0 .0
x 1 06
+ M S , 2 1 .9 -2 2 .0 m in # (5 3 6 1 -5 4 0 4 ), B a c kg ro u n d S u b tra c te d
2 .0
1 0 9 .1 0
1 .5
1 2 6 .9 8
1 .0
9 5 .2 0
0 .5
8 3 .3 4
5 5 .4 9
1 4 2 .9 5
6 9 .5 3
1 1 5 .0 41 2 1 .0 0
1 3 8 .9 4
1 5 2 .9 1
2 0 4 .9 3
0 .0
x 1 06
+ M S , 2 4 .0 -2 4 .3 m in # (5 8 9 0 -5 9 6 9 ), B a c kg ro u n d S u b tra c te d
2 .0
1 0 9 .0 9
1 .5
1 2 6 .9 7
1 .0
9 5 .2 1
0 .5
8 3 .3 4
1 4 2 .9 5
5 5 .4 9
6 9 .5 2
7 9 .3 7
1 2 0 .9 9
1 3 8 .9 4
1 5 2 .9 1
2 0 4 .9 2
0 .0
60
80
100
120
140
160
180
200
220
m /z
Bruker Daltonics DataAnalysis
Text (*.MSP) (n=220; s=1)
Text (*.xy) (n=220; s=1)
VB
Text (*.MSP) (n=220; s=219)
VB (if sample from Liguria then CAS=1, else CAS=2)
LIB2NIST
Liguria or non-Liguria?
 Non-Liguria; Probability =82.2%
NIST MS library
(n=220; s=219)
Origen geogràfico de las matrices
vegetales
Proyecto europeo
% Recognition
Technique
Miscellaneous
% Prediction
Liguria
Non-Liguria
Liguria
Non-Liguria
-
-
94
86
NIST-MS
weighted (n=2 and p=0.5) data
LDAb
9 m/z values selected: 92, 97, 117,
129, 165, 171, 183, 197, 241;
weighted (n=2 and p=0.5) and
centered data
93
84
89
79
PLS-DAc
3 PLS components selected;
boundary: 0.5; weighted (n=2 and
p=0.5) and centered data
96
83
92
81
kNNd
k = 4; weighted (n=2 and p=0.5)
90
84
88
82
85
86
84
81
and centered data
KohonenCPANNe
1
Net structure: 11x11; 60 epochs;
weighted (n=2 and p=0.5) and
centered data
Origen geogràfico de las matrices
vegetales
Proyecto europeo
Compounda
1
Molecular ion (m/z) Fragmentation pattern (m/z)
Pentanal and/or pentenol
Hexenal
Octenal
Octanal and/or octenol
Nonanal and/or nonenol
87
99
127
129
143
69
81, 71, 57
109, 99, 71, 67
111, 83, 69
125, 107, 97, 83
Decenal
Decanal and/or decenol
Caffeic acid
155
157
181
137, 109, 95, 81
139, 121, 111, 97
163, 153, 145, 135, 123
Identificación de proteínas
Proyecto Italia
Identificación de proteínas
Projecto Cytrus Subvención del Gobierno Italiano
Allergen
GLP
(putative
Cit c 1)
Profilin
(putative
Cit c 2)
nsLTP
(putative
Cit c 3)
1
Procedure
Log(e) protein
(a)
Attribution/residues alignment
Detected peptide sequence
m/z
(b)
z
(c)
Log(e) peptide
(a)
% protein coverage
1
-512.3
clementine0.9_021092m/
aa 23-39; 57-74; 75-99; 100-116; 145168; 169-180.
TDPGHLQDVCVAINDPK
AEDFFFSGLGKPGNTANR
LGVDETDANVEQIPGLNTLGISAFR
IDYAPYGQRPPHIHPR
VLNKGDVFVFPQGLIHFQFNIGK
TNAAAYSALNSQFPGEVTIADTVFGANPSINPDFLGK
939.9; 626.9
964.4; 643.3
877.1
639.6
873.1
1266.6
2; 3
2; 3
3
3
3
3
-9.0
-6.2
-8.4
-1.6
-3.3
-7.5
67.3
2
-508.0
clementine0.9_021092m
aa 23-39; 57-74; 75-99; 100-116; 145168; 169-180.
TDPGHLQDVCVAINDPK
AEDFFFSGLGKPGNTANR
LGVDETDANVEQIPGLNTLGISAFR
IDYAPYGQRPPHIHPR
VLNKGDVFVFPQGLIHFQFNIGK
TNAAAYSALNSQFPGEVTIADTVFGANPSINPDFLGK
939.9; 626.9
964.4; 643.3
877.1
639.6
873.1
1266.6
2; 3
2; 3
3
3
3
3
-2.7
-6.5
-8.6
-3.1
-3.2
-8.1
67.3
3
-541.1
clementine0.9_021092m
aa 23-39; 57-74; 75-99; 100-116; 145168; 169-180.
TDPGHLQDVCVAINDPK
AEDFFFSGLGKPGNTANR
LGVDETDANVEQIPGLNTLGISAFR
IDYAPYGQRPPHIHPR
VLNKGDVFVFPQGLIHFQFNIGK
TNAAAYSALNSQFPGEVTIADTVFGANPSINPDFLGK
939.9; 626.9
964.4; 643.3
877.1
639.6
873.1
1266.6
2; 3
2; 3
3
3
3
3
-6.0
-5.7
-7.5
-2.7
-6.0
-8.4
67.3
4
-507.9
clementine0.9_021092m
aa 23-39; 57-74; 75-99; 100-116; 145168; 169-180.
TDPGHLQDVCVAINDPK
AEDFFFSGLGKPGNTANR
LGVDETDANVEQIPGLNTLGISAFR
IDYAPYGQRPPHIHPR
VLNKGDVFVFPQGLIHFQFNIGK
TNAAAYSALNSQFPGEVTIADTVFGANPSINPDFLGK
939.9; 626.9
964.4; 643.3
877.1
639.6
873.1
1266.6
2; 3
2; 3
3
3
3
3
-4.5
-5.9
-10.2
-3.7
-7.5
-9.2
67.3
3
- 9.6
clementine0.9_025303m
aa 53-71; 72-84
DFEEPGSLAPTGLHLGGTK
YMVIQGEPGAVIR
963.5; 642.6
716.9
2
2
-2.6
-4.3
24.4
1
- 10.6
clementine0.9_025486m
aa 24-41;84-100.
ITCGQVTASLAPCIPFLR
GIKPNVAAGLPSQCGVR
1002.5
862.4; 575.3
2
2
-2.5
-5.2
34.0
3
- 8.5
clementine0.9_025486m
aa 24-41;84-100.
ITCGQVTASLAPCIPFLR
GIKPNVAAGLPSQCGVR
1002.5
862.4; 575.3
2
2
-2.0
-3.7
34.0
4
- 22.7
clementine0.9_025486m
aa 24-41;46-56; 84-100.
ITCGQVTASLAPCIPFLR
FPPPPCCSGVR
PPPPCCSGVR
GIKPNVAAGL PSQCGVR
1002.5
637.3
563.7
862.4; 575.3
2
2
2
2
-1.6
-2.5
-3.0
-3.1
44.7
Conclusiones
• La innovadora tecnología de bajo ruido
instrumental
• Amplias aplicaciones potenciales en el campo
agroindustrial
Contactos
Contactos:
Tel: +39 02.96474437
Info: [email protected]
http://www.isbiolab.com
ISB
Descargar

Ponencia Simone Cristoni